HORDB

ID: hor006005
Uniprot ID: P84213
Protein name: Bombesin
Gene name: NA
Organism: Bombina variegata (Yellow-bellied toad)
Family: Bombesin/neuromedin-B/ranatensin family
Source: animal
Expression: Expressed by the skin glands.
Disease: NA
Comments: NA
Taxonomy: Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0006952 defense response; GO:0007218 neuropeptide signaling pathway; GO:0045987 positive regulation of smooth muscle contraction; GO:0050796 regulation of insulin secretion
GO CC: GO:0005576 extracellular region

Sequence: QQRLGNQWAVGHLM
Length: 14
Propeptide: MSAIPLNRILPLGFLLIFSFISLSSCMEFVEDPNNQGGLNLQQRLGNQWAVGHLMGKKSLQDTDFEEMESFAKRNVENMKAESERELRHAQLVVRNILEQYLKNMQN
Signal peptide: MSAIPLNRILPLGFLLIFSFISLSSC
Modification: T1 Pyrrolidone carboxylic acid;T14 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates smooth muscle contraction. Role in induction of hypothermia, stimulation of DNA replication and release of many gastrointestinal hormones. Possesses insulin-releasing activity.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006005_AF2.pdb

hor006005_ESM.pdb

Mass:	186996	Formula:	C71H112N24O19S
Absent amino acids:	CDEFIKPSTY	Common amino acids:	Q
pI:	10.55	Basic residues:	2
Polar residues:	3	Hydrophobic residues:	5
Hydrophobicity:	-56.43	Boman Index:	-2059
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	83.57
Instability Index:	-520.71	Extinction Coefficient cystines:	5500
Absorbance 280nm:	423.08

PubMed ID: 2335218
Title: Molecular cloning of a cDNA encoding the bombesin precursor in skin of Bombina variegata.
PubMed ID: 4537042
Title: Isolation and amino acid sequences of alytesin and bombesin, two analogous active tetradecapeptides from the skin of European discoglossid frogs.
PubMed ID: 15134346
Title: Skin secretion of the toad Bombina variegata contains multiple insulin-releasing peptides including bombesin and entirely novel insulinotropic structures.